Brand: | Abnova |
Reference: | H00023353-M01 |
Product name: | UNC84A monoclonal antibody (M01), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant UNC84A. |
Clone: | 2D10 |
Isotype: | IgG2a Kappa |
Gene id: | 23353 |
Gene name: | UNC84A |
Gene alias: | FLJ12407|KIAA0810|MGC176649|SUN1 |
Gene description: | unc-84 homolog A (C. elegans) |
Genbank accession: | BC013613 |
Immunogen: | UNC84A (AAH13613, 1 a.a. ~ 257 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGSKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP |
Protein accession: | AAH13613 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (54.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |