Brand: | Abnova |
Reference: | H00023352-M01 |
Product name: | RBAF600 monoclonal antibody (M01), clone 2D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBAF600. |
Clone: | 2D12 |
Isotype: | IgG2b Kappa |
Gene id: | 23352 |
Gene name: | UBR4 |
Gene alias: | FLJ41863|KIAA0462|KIAA1307|RBAF600|ZUBR1|p600 |
Gene description: | ubiquitin protein ligase E3 component n-recognin 4 |
Genbank accession: | NM_020765 |
Immunogen: | RBAF600 (NP_065816, 94 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ |
Protein accession: | NP_065816 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RBAF600 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |