Cart 29 Product Products 8 934,64 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-IG...259,07 € -
1 x Dynactin 2...259,07 € -
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
8 934,64 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 29 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 934,64 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 934,64 €
Data sheet of SYNE1 monoclonal antibody (M02), clone 3G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SYNE1 monoclonal antibody (M02), clone 3G2
| Brand: | Abnova |
| Reference: | H00023345-M02 |
| Product name: | SYNE1 monoclonal antibody (M02), clone 3G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SYNE1. |
| Clone: | 3G2 |
| Isotype: | IgG3 Kappa |
| Gene id: | 23345 |
| Gene name: | SYNE1 |
| Gene alias: | 8B|CPG2|DKFZp781J13156|FLJ30878|FLJ41140|KIAA0796|KIAA1262|KIAA1756|MYNE1|SCAR8 |
| Gene description: | spectrin repeat containing, nuclear envelope 1 |
| Genbank accession: | NM_182961 |
| Immunogen: | SYNE1 (NP_892006, 1561 a.a. ~ 1670 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW |
| Protein accession: | NP_892006 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |