| Brand: | Abnova |
| Reference: | H00023345-M01 |
| Product name: | SYNE1 monoclonal antibody (M01), clone 4C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SYNE1. |
| Clone: | 4C3 |
| Isotype: | IgG3 Kappa |
| Gene id: | 23345 |
| Gene name: | SYNE1 |
| Gene alias: | 8B|CPG2|DKFZp781J13156|FLJ30878|FLJ41140|KIAA0796|KIAA1262|KIAA1756|MYNE1|SCAR8 |
| Gene description: | spectrin repeat containing, nuclear envelope 1 |
| Genbank accession: | NM_182961 |
| Immunogen: | SYNE1 (NP_892006, 1561 a.a. ~ 1670 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW |
| Protein accession: | NP_892006 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SYNE1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |