SYNE1 monoclonal antibody (M01), clone 4C3 View larger

SYNE1 monoclonal antibody (M01), clone 4C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYNE1 monoclonal antibody (M01), clone 4C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SYNE1 monoclonal antibody (M01), clone 4C3

Brand: Abnova
Reference: H00023345-M01
Product name: SYNE1 monoclonal antibody (M01), clone 4C3
Product description: Mouse monoclonal antibody raised against a partial recombinant SYNE1.
Clone: 4C3
Isotype: IgG3 Kappa
Gene id: 23345
Gene name: SYNE1
Gene alias: 8B|CPG2|DKFZp781J13156|FLJ30878|FLJ41140|KIAA0796|KIAA1262|KIAA1756|MYNE1|SCAR8
Gene description: spectrin repeat containing, nuclear envelope 1
Genbank accession: NM_182961
Immunogen: SYNE1 (NP_892006, 1561 a.a. ~ 1670 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW
Protein accession: NP_892006
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023345-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023345-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SYNE1 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SYNE1 monoclonal antibody (M01), clone 4C3 now

Add to cart