Cart 21 Product Products 6 507,29 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 21 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 507,29 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 507,29 €
Data sheet of DMN monoclonal antibody (M03), clone 4G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about DMN monoclonal antibody (M03), clone 4G5
| Brand: | Abnova |
| Reference: | H00023336-M03 |
| Product name: | DMN monoclonal antibody (M03), clone 4G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DMN. |
| Clone: | 4G5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23336 |
| Gene name: | SYNM |
| Gene alias: | DMN|KIAA0353|SYN |
| Gene description: | synemin, intermediate filament protein |
| Genbank accession: | NM_145728 |
| Immunogen: | DMN (NP_663780.1, 1466 a.a. ~ 1565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISDEKKVALLYLDNEEEENDGHWF |
| Protein accession: | NP_663780.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SYNM is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |