No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00023336-M03 |
Product name: | DMN monoclonal antibody (M03), clone 4G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DMN. |
Clone: | 4G5 |
Isotype: | IgG1 Kappa |
Gene id: | 23336 |
Gene name: | SYNM |
Gene alias: | DMN|KIAA0353|SYN |
Gene description: | synemin, intermediate filament protein |
Genbank accession: | NM_145728 |
Immunogen: | DMN (NP_663780.1, 1466 a.a. ~ 1565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISDEKKVALLYLDNEEEENDGHWF |
Protein accession: | NP_663780.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SYNM is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |