| Brand: | Abnova |
| Reference: | H00023327-M04 |
| Product name: | NEDD4L monoclonal antibody (M04), clone 1D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEDD4L. |
| Clone: | 1D2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23327 |
| Gene name: | NEDD4L |
| Gene alias: | FLJ33870|KIAA0439|NEDD4-2|RSP5|hNedd4-2 |
| Gene description: | neural precursor cell expressed, developmentally down-regulated 4-like |
| Genbank accession: | BC032597 |
| Immunogen: | NEDD4L (AAH32597, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT |
| Protein accession: | AAH32597 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of NEDD4L transfected lysate using anti-NEDD4L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NEDD4L monoclonal antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |