Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NEDD4L polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about NEDD4L polyclonal antibody (A01)
| Reference: | H00023327-A01 |
| Product name: | NEDD4L polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant NEDD4L. |
| Gene id: | 23327 |
| Gene name: | NEDD4L |
| Gene alias: | FLJ33870|KIAA0439|NEDD4-2|RSP5|hNedd4-2 |
| Gene description: | neural precursor cell expressed, developmentally down-regulated 4-like |
| Genbank accession: | BC032597 |
| Immunogen: | NEDD4L (AAH32597, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT |
| Protein accession: | AAH32597 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |