No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023310-M01 |
Product name: | KIAA0056 monoclonal antibody (M01), clone 1D5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant KIAA0056. |
Clone: | 1D5 |
Isotype: | IgG1 kappa |
Gene id: | 23310 |
Gene name: | NCAPD3 |
Gene alias: | CAP-D3|FLJ42888|KIAA0056|MGC104671|hCAP-D3|hHCP-6|hcp-6 |
Gene description: | non-SMC condensin II complex, subunit D3 |
Genbank accession: | BC011408.1 |
Immunogen: | KIAA0056 (AAH11408.1, 1 a.a. ~ 341 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAI |
Protein accession: | AAH11408.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (63.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to KIAA0056 on formalin-fixed paraffin-embedded human breast cancer tissue.[antibody concentration 2 ug/ml] |
Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |