| Brand: | Abnova |
| Reference: | H00023309-M02 |
| Product name: | SIN3B monoclonal antibody (M02), clone 2C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIN3B. |
| Clone: | 2C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23309 |
| Gene name: | SIN3B |
| Gene alias: | KIAA0700 |
| Gene description: | SIN3 homolog B, transcription regulator (yeast) |
| Genbank accession: | NM_015260 |
| Immunogen: | SIN3B (NP_056075.1, 1063 a.a. ~ 1160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA |
| Protein accession: | NP_056075.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SIN3B is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |