| Brand: | Abnova |
| Reference: | H00023308-M10 |
| Product name: | ICOSLG monoclonal antibody (M10), clone 3F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ICOSLG. |
| Clone: | 3F7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23308 |
| Gene name: | ICOSLG |
| Gene alias: | B7-H2|B7H2|B7RP-1|B7RP1|CD275|GL50|ICOS-L|ICOSL|KIAA0653|LICOS |
| Gene description: | inducible T-cell co-stimulator ligand |
| Genbank accession: | BC064637.1 |
| Immunogen: | ICOSLG (AAH64637.1, 18 a.a. ~ 135 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVA |
| Protein accession: | AAH64637.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (15.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |