| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00023304-M01A |
| Product name: | UBR2 monoclonal antibody (M01A), clone 4G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UBR2. |
| Clone: | 4G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23304 |
| Gene name: | UBR2 |
| Gene alias: | C6orf133|DKFZp686C08114|KIAA0349|MGC71112|RP3-392M17.3|bA49A4.1|dJ242G1.1|dJ392M17.3 |
| Gene description: | ubiquitin protein ligase E3 component n-recognin 2 |
| Genbank accession: | NM_015255 |
| Immunogen: | UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG |
| Protein accession: | NP_056070 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody (M01A), clone 4G4. Lane 1: UBR2 transfected lysate(50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |