View larger

UBR2 monoclonal antibody (M01A), clone 4G4

Reference:

Condition: New product

Data sheet of UBR2 monoclonal antibody (M01A), clone 4G4

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	ELISA,WB-Re,WB-Tr

More info about UBR2 monoclonal antibody (M01A), clone 4G4

Brand:	Abnova
Reference:	H00023304-M01A
Product name:	UBR2 monoclonal antibody (M01A), clone 4G4
Product description:	Mouse monoclonal antibody raised against a partial recombinant UBR2.
Clone:	4G4
Isotype:	IgG2a Kappa
Gene id:	23304
Gene name:	UBR2
Gene alias:	C6orf133\|DKFZp686C08114\|KIAA0349\|MGC71112\|RP3-392M17.3\|bA49A4.1\|dJ242G1.1\|dJ392M17.3
Gene description:	ubiquitin protein ligase E3 component n-recognin 2
Genbank accession:	NM_015255
Immunogen:	UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG
Protein accession:	NP_056070
Storage buffer:	In ascites fluid
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.74 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody (M01A), clone 4G4. Lane 1: UBR2 transfected lysate(50 KDa). Lane 2: Non-transfected lysate.
Applications:	ELISA,WB-Re,WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy UBR2 monoclonal antibody (M01A), clone 4G4 now

Add to cart