No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023287-M03 |
Product name: | AGTPBP1 monoclonal antibody (M03), clone 2B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AGTPBP1. |
Clone: | 2B9 |
Isotype: | IgG1 Kappa |
Gene id: | 23287 |
Gene name: | AGTPBP1 |
Gene alias: | DKFZp686M20191|KIAA1035|NNA1 |
Gene description: | ATP/GTP binding protein 1 |
Genbank accession: | NM_015239 |
Immunogen: | AGTPBP1 (NP_056054, 1087 a.a. ~ 1186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP |
Protein accession: | NP_056054 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | AGTPBP1 monoclonal antibody (M03), clone 2B9. Western Blot analysis of AGTPBP1 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |