| Brand: | Abnova |
| Reference: | H00023268-M01C |
| Product name: | DNMBP monoclonal antibody (M01C), clone 1H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DNMBP. |
| Clone: | 1H2 |
| Isotype: | IgG3 Kappa |
| Gene id: | 23268 |
| Gene name: | DNMBP |
| Gene alias: | KIAA1010|TUBA |
| Gene description: | dynamin binding protein |
| Genbank accession: | BC041628 |
| Immunogen: | DNMBP (AAH41628, 491 a.a. ~ 590 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLK |
| Protein accession: | AAH41628 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |