| Brand: | Abnova |
| Reference: | H00023263-M01 |
| Product name: | MCF2L monoclonal antibody (M01), clone 1D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MCF2L. |
| Clone: | 1D11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23263 |
| Gene name: | MCF2L |
| Gene alias: | ARHGEF14|DBS|FLJ12122|KIAA0362|OST |
| Gene description: | MCF.2 cell line derived transforming sequence-like |
| Genbank accession: | BC020208 |
| Immunogen: | MCF2L (AAH20208, 220 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCL |
| Protein accession: | AAH20208 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MCF2L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |