No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023263-M01 |
Product name: | MCF2L monoclonal antibody (M01), clone 1D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MCF2L. |
Clone: | 1D11 |
Isotype: | IgG1 Kappa |
Gene id: | 23263 |
Gene name: | MCF2L |
Gene alias: | ARHGEF14|DBS|FLJ12122|KIAA0362|OST |
Gene description: | MCF.2 cell line derived transforming sequence-like |
Genbank accession: | BC020208 |
Immunogen: | MCF2L (AAH20208, 220 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCL |
Protein accession: | AAH20208 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to MCF2L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |