SIK2 monoclonal antibody (M01), clone 4H6 View larger

SIK2 monoclonal antibody (M01), clone 4H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIK2 monoclonal antibody (M01), clone 4H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SIK2 monoclonal antibody (M01), clone 4H6

Brand: Abnova
Reference: H00023235-M01
Product name: SIK2 monoclonal antibody (M01), clone 4H6
Product description: Mouse monoclonal antibody raised against a partial recombinant SIK2.
Clone: 4H6
Isotype: IgG2a Kappa
Gene id: 23235
Gene name: SIK2
Gene alias: DKFZp434K1115|KIAA0781|LOH11CR1I|QIK|SNF1LK2
Gene description: salt-inducible kinase 2
Genbank accession: NM_015191
Immunogen: SIK2 (NP_056006, 467 a.a. ~ 576 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AHAFEAFQSTRSGQRRHTLSEVTNQLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNPAMQALSSQKREVHNRS
Protein accession: NP_056006
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023235-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged SIK2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Related products: - SIK2 monoclonal antibody (M03), clone 4C6
- MCF2L monoclonal antibody (M01), clone 1D11
- EXOC7 monoclonal antibody (M01), clone 1D4
- EXOC7 monoclonal antibody (M05), clone 1B7
- DNMBP monoclonal antibody (M01), clone 1H2
Shipping condition: Dry Ice

Buy SIK2 monoclonal antibody (M01), clone 4H6 now

Add to cart