ARHGEF9 (Human) Recombinant Protein (Q01) View larger

ARHGEF9 (Human) Recombinant Protein (Q01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGEF9 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ARHGEF9 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00023229-Q01
Product name: ARHGEF9 (Human) Recombinant Protein (Q01)
Product description: Human ARHGEF9 partial ORF ( NP_056000.1, 419 a.a. - 516 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 23229
Gene name: ARHGEF9
Gene alias: COLLYBISTIN|HPEM-2|KIAA0424|PEM-2|PEM2
Gene description: Cdc42 guanine nucleotide exchange factor (GEF) 9
Genbank accession: NM_015185
Immunogen sequence/protein sequence: AFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Protein accession: NP_056000.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00023229-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - KIAA0746 (Human) Recombinant Protein (P01)
- SIK2 (Human) Recombinant Protein (Q01)
- PLCB1 (Human) Recombinant Protein (Q01)
- ARC (Human) Recombinant Protein (P01)
- PACS2 (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy ARHGEF9 (Human) Recombinant Protein (Q01) now

Add to cart