ARHGEF9 monoclonal antibody (M01), clone 3C11 View larger

ARHGEF9 monoclonal antibody (M01), clone 3C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGEF9 monoclonal antibody (M01), clone 3C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ARHGEF9 monoclonal antibody (M01), clone 3C11

Brand: Abnova
Reference: H00023229-M01
Product name: ARHGEF9 monoclonal antibody (M01), clone 3C11
Product description: Mouse monoclonal antibody raised against a partial recombinant ARHGEF9.
Clone: 3C11
Isotype: IgG2a Kappa
Gene id: 23229
Gene name: ARHGEF9
Gene alias: COLLYBISTIN|HPEM-2|KIAA0424|PEM-2|PEM2
Gene description: Cdc42 guanine nucleotide exchange factor (GEF) 9
Genbank accession: NM_015185
Immunogen: ARHGEF9 (NP_056000.1, 419 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Protein accession: NP_056000.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023229-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023229-M01-1-7-1.jpg
Application image note: ARHGEF9 monoclonal antibody (M01), clone 3C11. Western Blot analysis of ARHGEF9 expression in MCF-7.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Related products: - SIK2 monoclonal antibody (M01), clone 4H6
- SIK2 monoclonal antibody (M03), clone 4C6
- MCF2L monoclonal antibody (M01), clone 1D11
- EXOC7 monoclonal antibody (M01), clone 1D4
- EXOC7 monoclonal antibody (M05), clone 1B7
Shipping condition: Dry Ice

Buy ARHGEF9 monoclonal antibody (M01), clone 3C11 now

Add to cart