View larger

ARHGEF9 monoclonal antibody (M01), clone 3C11

Reference:

Condition: New product

Data sheet of ARHGEF9 monoclonal antibody (M01), clone 3C11

Brand:	Abnova
Reference:	H00023229-M01
Product name:	ARHGEF9 monoclonal antibody (M01), clone 3C11
Product description:	Mouse monoclonal antibody raised against a partial recombinant ARHGEF9.
Clone:	3C11
Isotype:	IgG2a Kappa
Gene id:	23229
Gene name:	ARHGEF9
Gene alias:	COLLYBISTIN\|HPEM-2\|KIAA0424\|PEM-2\|PEM2
Gene description:	Cdc42 guanine nucleotide exchange factor (GEF) 9
Genbank accession:	NM_015185
Immunogen:	ARHGEF9 (NP_056000.1, 419 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	AFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Protein accession:	NP_056000.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.52 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	ARHGEF9 monoclonal antibody (M01), clone 3C11. Western Blot analysis of ARHGEF9 expression in MCF-7.
Applications:	WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice