PLCL2 monoclonal antibody (M01), clone 2D10 View larger

PLCL2 monoclonal antibody (M01), clone 2D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLCL2 monoclonal antibody (M01), clone 2D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PLCL2 monoclonal antibody (M01), clone 2D10

Brand: Abnova
Reference: H00023228-M01
Product name: PLCL2 monoclonal antibody (M01), clone 2D10
Product description: Mouse monoclonal antibody raised against a partial recombinant PLCL2.
Clone: 2D10
Isotype: IgG2a Kappa
Gene id: 23228
Gene name: PLCL2
Gene alias: FLJ13484|KIAA1092|PLCE2
Gene description: phospholipase C-like 2
Genbank accession: BC036392
Immunogen: PLCL2 (AAH36392, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFH
Protein accession: AAH36392
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023228-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023228-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PLCL2 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Related products: - PLCL2 monoclonal antibody (M02), clone 1C7
- ARHGEF9 monoclonal antibody (M01), clone 3C11
- SIK2 monoclonal antibody (M01), clone 4H6
- SIK2 monoclonal antibody (M03), clone 4C6
- MCF2L monoclonal antibody (M01), clone 1D11
Shipping condition: Dry Ice

Buy PLCL2 monoclonal antibody (M01), clone 2D10 now

Add to cart