SYNE2 monoclonal antibody (M01), clone 5E5 View larger

SYNE2 monoclonal antibody (M01), clone 5E5

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYNE2 monoclonal antibody (M01), clone 5E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about SYNE2 monoclonal antibody (M01), clone 5E5

Brand: Abnova
Reference: H00023224-M01
Product name: SYNE2 monoclonal antibody (M01), clone 5E5
Product description: Mouse monoclonal antibody raised against a partial recombinant SYNE2.
Clone: 5E5
Isotype: IgG2b Kappa
Gene id: 23224
Gene name: SYNE2
Gene alias: DKFZp434H2235|DKFZp686E01115|DKFZp686H1931|FLJ11014|FLJ43727|FLJ45710|FLJ46790|KIAA1011|NUA|NUANCE|Nesprin-2|SYNE-2
Gene description: spectrin repeat containing, nuclear envelope 2
Genbank accession: NM_015180
Immunogen: SYNE2 (NP_055995, 6702 a.a. ~ 6799 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
Protein accession: NP_055995
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023224-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023224-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SYNE2 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Related products: - PLCL2 monoclonal antibody (M01), clone 2D10
- PLCL2 monoclonal antibody (M02), clone 1C7
- ARHGEF9 monoclonal antibody (M01), clone 3C11
- SIK2 monoclonal antibody (M01), clone 4H6
- SIK2 monoclonal antibody (M03), clone 4C6
Shipping condition: Dry Ice

Buy SYNE2 monoclonal antibody (M01), clone 5E5 now

Add to cart