SYNE2 polyclonal antibody (A01) View larger

SYNE2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYNE2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SYNE2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00023224-A01
Product name: SYNE2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SYNE2.
Gene id: 23224
Gene name: SYNE2
Gene alias: DKFZp434H2235|DKFZp686E01115|DKFZp686H1931|FLJ11014|FLJ43727|FLJ45710|FLJ46790|KIAA1011|NUA|NUANCE|Nesprin-2|SYNE-2
Gene description: spectrin repeat containing, nuclear envelope 2
Genbank accession: NM_015180
Immunogen: SYNE2 (NP_055995, 6702 a.a. ~ 6799 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
Protein accession: NP_055995
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023224-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - PLCL2 MaxPab mouse polyclonal antibody (B01)
- EXOC6B purified MaxPab mouse polyclonal antibody (B01P)
- SIK2 MaxPab mouse polyclonal antibody (B01)
- PLCB1 polyclonal antibody (A01)
- ARC purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice
Publications: A Mutation in Syne2 Causes Early Retinal Defects in Photoreceptors, Secondary Neurons, and Muller Glia.Maddox DM, Collin GB, Ikeda A, Pratt CH, Ikeda S, Johnson BA, Hurd RE, Shopland LS, Naggert JK, Chang B, Krebs MP, Nishina PM.
Invest Ophthalmol Vis Sci. 2015 Jun;56(6):3776-87.

Buy SYNE2 polyclonal antibody (A01) now

Add to cart