| Brand: | Abnova |
| Reference: | H00023224-A01 |
| Product name: | SYNE2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SYNE2. |
| Gene id: | 23224 |
| Gene name: | SYNE2 |
| Gene alias: | DKFZp434H2235|DKFZp686E01115|DKFZp686H1931|FLJ11014|FLJ43727|FLJ45710|FLJ46790|KIAA1011|NUA|NUANCE|Nesprin-2|SYNE-2 |
| Gene description: | spectrin repeat containing, nuclear envelope 2 |
| Genbank accession: | NM_015180 |
| Immunogen: | SYNE2 (NP_055995, 6702 a.a. ~ 6799 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA |
| Protein accession: | NP_055995 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Mutation in Syne2 Causes Early Retinal Defects in Photoreceptors, Secondary Neurons, and Muller Glia.Maddox DM, Collin GB, Ikeda A, Pratt CH, Ikeda S, Johnson BA, Hurd RE, Shopland LS, Naggert JK, Chang B, Krebs MP, Nishina PM. Invest Ophthalmol Vis Sci. 2015 Jun;56(6):3776-87. |