RHOBTB2 monoclonal antibody (M02), clone 2G6 View larger

RHOBTB2 monoclonal antibody (M02), clone 2G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOBTB2 monoclonal antibody (M02), clone 2G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RHOBTB2 monoclonal antibody (M02), clone 2G6

Brand: Abnova
Reference: H00023221-M02
Product name: RHOBTB2 monoclonal antibody (M02), clone 2G6
Product description: Mouse monoclonal antibody raised against a partial recombinant RHOBTB2.
Clone: 2G6
Isotype: IgG2a Kappa
Gene id: 23221
Gene name: RHOBTB2
Gene alias: DBC2|KIAA0717
Gene description: Rho-related BTB domain containing 2
Genbank accession: BC034917
Immunogen: RHOBTB2 (AAH34917, 510 a.a. ~ 619 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELA
Protein accession: AAH34917
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023221-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged RHOBTB2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Related products: - SYNE2 monoclonal antibody (M01), clone 5E5
- PLCL2 monoclonal antibody (M01), clone 2D10
- PLCL2 monoclonal antibody (M02), clone 1C7
- ARHGEF9 monoclonal antibody (M01), clone 3C11
- SIK2 monoclonal antibody (M01), clone 4H6
Shipping condition: Dry Ice

Buy RHOBTB2 monoclonal antibody (M02), clone 2G6 now

Add to cart