Login to display prices
Login to display prices
RHOBTB2 monoclonal antibody (M02), clone 2G6 View larger

RHOBTB2 monoclonal antibody (M02), clone 2G6

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOBTB2 monoclonal antibody (M02), clone 2G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RHOBTB2 monoclonal antibody (M02), clone 2G6

Reference: H00023221-M02
Product name: RHOBTB2 monoclonal antibody (M02), clone 2G6
Product description: Mouse monoclonal antibody raised against a partial recombinant RHOBTB2.
Clone: 2G6
Isotype: IgG2a Kappa
Gene id: 23221
Gene name: RHOBTB2
Gene alias: DBC2|KIAA0717
Gene description: Rho-related BTB domain containing 2
Genbank accession: BC034917
Immunogen: RHOBTB2 (AAH34917, 510 a.a. ~ 619 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELA
Protein accession: AAH34917
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: