No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00023221-M02 |
| Product name: | RHOBTB2 monoclonal antibody (M02), clone 2G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RHOBTB2. |
| Clone: | 2G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23221 |
| Gene name: | RHOBTB2 |
| Gene alias: | DBC2|KIAA0717 |
| Gene description: | Rho-related BTB domain containing 2 |
| Genbank accession: | BC034917 |
| Immunogen: | RHOBTB2 (AAH34917, 510 a.a. ~ 619 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELA |
| Protein accession: | AAH34917 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged RHOBTB2 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |