Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00023221-M02 |
Product name: | RHOBTB2 monoclonal antibody (M02), clone 2G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RHOBTB2. |
Clone: | 2G6 |
Isotype: | IgG2a Kappa |
Gene id: | 23221 |
Gene name: | RHOBTB2 |
Gene alias: | DBC2|KIAA0717 |
Gene description: | Rho-related BTB domain containing 2 |
Genbank accession: | BC034917 |
Immunogen: | RHOBTB2 (AAH34917, 510 a.a. ~ 619 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELA |
Protein accession: | AAH34917 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged RHOBTB2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Related products: | - SYNE2 monoclonal antibody (M01), clone 5E5 - PLCL2 monoclonal antibody (M01), clone 2D10 - PLCL2 monoclonal antibody (M02), clone 1C7 - ARHGEF9 monoclonal antibody (M01), clone 3C11 - SIK2 monoclonal antibody (M01), clone 4H6 |
Shipping condition: | Dry Ice |