Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023219-Q01 |
Product name: | FBXO28 (Human) Recombinant Protein (Q01) |
Product description: | Human FBXO28 partial ORF ( NP_055991, 191 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 23219 |
Gene name: | FBXO28 |
Gene alias: | FLJ10766|Fbx28|KIAA0483 |
Gene description: | F-box protein 28 |
Genbank accession: | NM_015176 |
Immunogen sequence/protein sequence: | QRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQ |
Protein accession: | NP_055991 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Related products: | - RHOBTB2 (Human) Recombinant Protein (P01) - RHOBTB2 (Human) Recombinant Protein (Q01) - SYNE2 (Human) Recombinant Protein (Q01) - NUP210 (Human) Recombinant Protein (P01) - PLCL2 (Human) Recombinant Protein (P01) |
Shipping condition: | Dry Ice |