FBXO28 monoclonal antibody (M01), clone 3E5 View larger

FBXO28 monoclonal antibody (M01), clone 3E5

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO28 monoclonal antibody (M01), clone 3E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about FBXO28 monoclonal antibody (M01), clone 3E5

Brand: Abnova
Reference: H00023219-M01
Product name: FBXO28 monoclonal antibody (M01), clone 3E5
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO28.
Clone: 3E5
Isotype: IgG2a Kappa
Gene id: 23219
Gene name: FBXO28
Gene alias: FLJ10766|Fbx28|KIAA0483
Gene description: F-box protein 28
Genbank accession: NM_015176
Immunogen: FBXO28 (NP_055991, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQ
Protein accession: NP_055991
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023219-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged FBXO28 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Related products: - RHOBTB2 monoclonal antibody (M02), clone 2G6
- SYNE2 monoclonal antibody (M01), clone 5E5
- PLCL2 monoclonal antibody (M01), clone 2D10
- PLCL2 monoclonal antibody (M02), clone 1C7
- ARHGEF9 monoclonal antibody (M01), clone 3C11
Shipping condition: Dry Ice

Buy FBXO28 monoclonal antibody (M01), clone 3E5 now

Add to cart