Login to display prices
Login to display prices
FBXO28 monoclonal antibody (M01), clone 3E5 View larger

FBXO28 monoclonal antibody (M01), clone 3E5

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO28 monoclonal antibody (M01), clone 3E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about FBXO28 monoclonal antibody (M01), clone 3E5

Reference: H00023219-M01
Product name: FBXO28 monoclonal antibody (M01), clone 3E5
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXO28.
Clone: 3E5
Isotype: IgG2a Kappa
Gene id: 23219
Gene name: FBXO28
Gene alias: FLJ10766|Fbx28|KIAA0483
Gene description: F-box protein 28
Genbank accession: NM_015176
Immunogen: FBXO28 (NP_055991, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQ
Protein accession: NP_055991
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: