FBXO28 polyclonal antibody (A01) View larger

FBXO28 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO28 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about FBXO28 polyclonal antibody (A01)

Brand: Abnova
Reference: H00023219-A01
Product name: FBXO28 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FBXO28.
Gene id: 23219
Gene name: FBXO28
Gene alias: FLJ10766|Fbx28|KIAA0483
Gene description: F-box protein 28
Genbank accession: NM_015176
Immunogen: FBXO28 (NP_055991, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQ
Protein accession: NP_055991
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023219-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023219-A01-1-22-1.jpg
Application image note: FBXO28 polyclonal antibody (A01), Lot # 051102JC01 Western Blot analysis of FBXO28 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXO28 polyclonal antibody (A01) now

Add to cart