Login to display prices
Login to display prices
SULF1 (Human) Recombinant Protein (Q02) View larger

SULF1 (Human) Recombinant Protein (Q02)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULF1 (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SULF1 (Human) Recombinant Protein (Q02)

Reference: H00023213-Q02
Product name: SULF1 (Human) Recombinant Protein (Q02)
Product description: Human SULF1 partial ORF ( NP_055985.1, 780 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 23213
Gene name: SULF1
Gene alias: FLJ30905|FLJ38022|FLJ41750|HSULF-1|KIAA1077|SULF-1
Gene description: sulfatase 1
Genbank accession: NM_015170
Immunogen sequence/protein sequence: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Protein accession: NP_055985.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: