Login to display prices
Login to display prices
SULF1 monoclonal antibody (M01A), clone 1A4 View larger

SULF1 monoclonal antibody (M01A), clone 1A4

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULF1 monoclonal antibody (M01A), clone 1A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SULF1 monoclonal antibody (M01A), clone 1A4

Reference: H00023213-M01A
Product name: SULF1 monoclonal antibody (M01A), clone 1A4
Product description: Mouse monoclonal antibody raised against a partial recombinant SULF1.
Clone: 1A4
Isotype: IgM Kappa
Gene id: 23213
Gene name: SULF1
Gene alias: FLJ30905|FLJ38022|FLJ41750|HSULF-1|KIAA1077|SULF-1
Gene description: sulfatase 1
Genbank accession: NM_015170
Immunogen: SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Protein accession: NP_055985.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: