SULF1 monoclonal antibody (M01A), clone 1A4 View larger

SULF1 monoclonal antibody (M01A), clone 1A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULF1 monoclonal antibody (M01A), clone 1A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SULF1 monoclonal antibody (M01A), clone 1A4

Brand: Abnova
Reference: H00023213-M01A
Product name: SULF1 monoclonal antibody (M01A), clone 1A4
Product description: Mouse monoclonal antibody raised against a partial recombinant SULF1.
Clone: 1A4
Isotype: IgM Kappa
Gene id: 23213
Gene name: SULF1
Gene alias: FLJ30905|FLJ38022|FLJ41750|HSULF-1|KIAA1077|SULF-1
Gene description: sulfatase 1
Genbank accession: NM_015170
Immunogen: SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Protein accession: NP_055985.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023213-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - FBXO28 monoclonal antibody (M01), clone 3E5
- RHOBTB2 monoclonal antibody (M02), clone 2G6
- SYNE2 monoclonal antibody (M01), clone 5E5
- PLCL2 monoclonal antibody (M01), clone 2D10
- PLCL2 monoclonal antibody (M02), clone 1C7
Shipping condition: Dry Ice

Buy SULF1 monoclonal antibody (M01A), clone 1A4 now

Add to cart