PTDSR polyclonal antibody (A01) View larger

PTDSR polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTDSR polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PTDSR polyclonal antibody (A01)

Brand: Abnova
Reference: H00023210-A01
Product name: PTDSR polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PTDSR.
Gene id: 23210
Gene name: JMJD6
Gene alias: KIAA0585|PSR|PTDSR|PTDSR1
Gene description: jumonji domain containing 6
Genbank accession: NM_015167
Immunogen: PTDSR (NP_055982, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFK
Protein accession: NP_055982
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023210-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - RRS1 purified MaxPab mouse polyclonal antibody (B02P)
- RRS1 MaxPab rabbit polyclonal antibody (D01)
- RRS1 purified MaxPab rabbit polyclonal antibody (D01P)
- SULF1 purified MaxPab mouse polyclonal antibody (B01P)
- SULF1 purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy PTDSR polyclonal antibody (A01) now

Add to cart