Login to display prices
Login to display prices
PTDSR polyclonal antibody (A01) View larger

PTDSR polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTDSR polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PTDSR polyclonal antibody (A01)

Reference: H00023210-A01
Product name: PTDSR polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PTDSR.
Gene id: 23210
Gene name: JMJD6
Gene alias: KIAA0585|PSR|PTDSR|PTDSR1
Gene description: jumonji domain containing 6
Genbank accession: NM_015167
Immunogen: PTDSR (NP_055982, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFK
Protein accession: NP_055982
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: