No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023208-M03 |
Product name: | SYT11 monoclonal antibody (M03), clone 4E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SYT11. |
Clone: | 4E1 |
Isotype: | IgG1 Kappa |
Gene id: | 23208 |
Gene name: | SYT11 |
Gene alias: | DKFZp781D015|KIAA0080|MGC10881|MGC17226|SYT12 |
Gene description: | synaptotagmin XI |
Genbank accession: | NM_152280 |
Immunogen: | SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL |
Protein accession: | NP_689493 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (31.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to SYT11 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |