Login to display prices
Login to display prices
SYT11 monoclonal antibody (M03), clone 4E1 View larger

SYT11 monoclonal antibody (M03), clone 4E1

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYT11 monoclonal antibody (M03), clone 4E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about SYT11 monoclonal antibody (M03), clone 4E1

Reference: H00023208-M03
Product name: SYT11 monoclonal antibody (M03), clone 4E1
Product description: Mouse monoclonal antibody raised against a partial recombinant SYT11.
Clone: 4E1
Isotype: IgG1 Kappa
Gene id: 23208
Gene name: SYT11
Gene alias: DKFZp781D015|KIAA0080|MGC10881|MGC17226|SYT12
Gene description: synaptotagmin XI
Genbank accession: NM_152280
Immunogen: SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL
Protein accession: NP_689493
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: