No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00023208-M03 |
| Product name: | SYT11 monoclonal antibody (M03), clone 4E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SYT11. |
| Clone: | 4E1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23208 |
| Gene name: | SYT11 |
| Gene alias: | DKFZp781D015|KIAA0080|MGC10881|MGC17226|SYT12 |
| Gene description: | synaptotagmin XI |
| Genbank accession: | NM_152280 |
| Immunogen: | SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL |
| Protein accession: | NP_689493 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to SYT11 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |