SYT11 monoclonal antibody (M03), clone 4E1 View larger

SYT11 monoclonal antibody (M03), clone 4E1

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYT11 monoclonal antibody (M03), clone 4E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about SYT11 monoclonal antibody (M03), clone 4E1

Brand: Abnova
Reference: H00023208-M03
Product name: SYT11 monoclonal antibody (M03), clone 4E1
Product description: Mouse monoclonal antibody raised against a partial recombinant SYT11.
Clone: 4E1
Isotype: IgG1 Kappa
Gene id: 23208
Gene name: SYT11
Gene alias: DKFZp781D015|KIAA0080|MGC10881|MGC17226|SYT12
Gene description: synaptotagmin XI
Genbank accession: NM_152280
Immunogen: SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL
Protein accession: NP_689493
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023208-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023208-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SYT11 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Related products: - SULF1 monoclonal antibody (M01A), clone 1A4
- FBXO28 monoclonal antibody (M01), clone 3E5
- RHOBTB2 monoclonal antibody (M02), clone 2G6
- SYNE2 monoclonal antibody (M01), clone 5E5
- PLCL2 monoclonal antibody (M01), clone 2D10
Shipping condition: Dry Ice

Buy SYT11 monoclonal antibody (M03), clone 4E1 now

Add to cart