SYT11 polyclonal antibody (A01) View larger

SYT11 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYT11 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SYT11 polyclonal antibody (A01)

Brand: Abnova
Reference: H00023208-A01
Product name: SYT11 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SYT11.
Gene id: 23208
Gene name: SYT11
Gene alias: DKFZp781D015|KIAA0080|MGC10881|MGC17226|SYT12
Gene description: synaptotagmin XI
Genbank accession: NM_152280
Immunogen: SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL
Protein accession: NP_689493
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023208-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.27 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - PTDSR polyclonal antibody (A01)
- RRS1 purified MaxPab mouse polyclonal antibody (B02P)
- RRS1 MaxPab rabbit polyclonal antibody (D01)
- RRS1 purified MaxPab rabbit polyclonal antibody (D01P)
- SULF1 purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice

Buy SYT11 polyclonal antibody (A01) now

Add to cart