Login to display prices
Login to display prices
SYT11 polyclonal antibody (A01) View larger

SYT11 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYT11 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SYT11 polyclonal antibody (A01)

Reference: H00023208-A01
Product name: SYT11 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SYT11.
Gene id: 23208
Gene name: SYT11
Gene alias: DKFZp781D015|KIAA0080|MGC10881|MGC17226|SYT12
Gene description: synaptotagmin XI
Genbank accession: NM_152280
Immunogen: SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL
Protein accession: NP_689493
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: