ARL6IP monoclonal antibody (M09), clone 4F9 View larger

ARL6IP monoclonal antibody (M09), clone 4F9

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL6IP monoclonal antibody (M09), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ARL6IP monoclonal antibody (M09), clone 4F9

Brand: Abnova
Reference: H00023204-M09
Product name: ARL6IP monoclonal antibody (M09), clone 4F9
Product description: Mouse monoclonal antibody raised against a full-length recombinant ARL6IP.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 23204
Gene name: ARL6IP1
Gene alias: AIP1|ARL6IP|ARMER|KIAA0069
Gene description: ADP-ribosylation factor-like 6 interacting protein 1
Genbank accession: BC010281
Immunogen: ARL6IP (AAH10281, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Protein accession: AAH10281
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Related products: - SYT11 monoclonal antibody (M03), clone 4E1
- SULF1 monoclonal antibody (M01A), clone 1A4
- FBXO28 monoclonal antibody (M01), clone 3E5
- RHOBTB2 monoclonal antibody (M02), clone 2G6
- SYNE2 monoclonal antibody (M01), clone 5E5
Shipping condition: Dry Ice

Buy ARL6IP monoclonal antibody (M09), clone 4F9 now

Add to cart