Login to display prices
Login to display prices
ARL6IP monoclonal antibody (M09), clone 4F9 View larger

ARL6IP monoclonal antibody (M09), clone 4F9

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL6IP monoclonal antibody (M09), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA

More info about ARL6IP monoclonal antibody (M09), clone 4F9

Reference: H00023204-M09
Product name: ARL6IP monoclonal antibody (M09), clone 4F9
Product description: Mouse monoclonal antibody raised against a full-length recombinant ARL6IP.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 23204
Gene name: ARL6IP1
Gene alias: AIP1|ARL6IP|ARMER|KIAA0069
Gene description: ADP-ribosylation factor-like 6 interacting protein 1
Genbank accession: BC010281
Immunogen: ARL6IP (AAH10281, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Protein accession: AAH10281
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: