Login to display prices
Login to display prices
ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P) View larger

ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)

Reference: H00023204-B02P
Product name: ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human ARL6IP1 protein.
Gene id: 23204
Gene name: ARL6IP1
Gene alias: AIP1|ARL6IP|ARMER|KIAA0069
Gene description: ADP-ribosylation factor-like 6 interacting protein 1
Genbank accession: NM_015161.1
Immunogen: ARL6IP1 (NP_055976.1, 1 a.a. ~ 203 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Protein accession: NP_055976.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: