ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P) View larger

ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00023204-B02P
Product name: ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human ARL6IP1 protein.
Gene id: 23204
Gene name: ARL6IP1
Gene alias: AIP1|ARL6IP|ARMER|KIAA0069
Gene description: ADP-ribosylation factor-like 6 interacting protein 1
Genbank accession: NM_015161.1
Immunogen: ARL6IP1 (NP_055976.1, 1 a.a. ~ 203 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Protein accession: NP_055976.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023204-B02P-13-15-1.jpg
Application image note: Western Blot analysis of ARL6IP1 expression in transfected 293T cell line (H00023204-T02) by ARL6IP1 MaxPab polyclonal antibody.

Lane 1: ARL6IP transfected lysate(22.33 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Related products: - ACSBG1 MaxPab mouse polyclonal antibody (B01)
- ACSBG1 purified MaxPab mouse polyclonal antibody (B01P)
- SYT11 polyclonal antibody (A01)
- PTDSR polyclonal antibody (A01)
- RRS1 purified MaxPab mouse polyclonal antibody (B02P)
Shipping condition: Dry Ice

Buy ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart