Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00023204-B01 |
Product name: | ARL6IP MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human ARL6IP protein. |
Gene id: | 23204 |
Gene name: | ARL6IP1 |
Gene alias: | AIP1|ARL6IP|ARMER|KIAA0069 |
Gene description: | ADP-ribosylation factor-like 6 interacting protein 1 |
Genbank accession: | BC010281 |
Immunogen: | ARL6IP (AAH10281, 1 a.a. ~ 203 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE |
Protein accession: | AAH10281 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ARL6IP1 expression in transfected 293T cell line (H00023204-T01) by ARL6IP1 MaxPab polyclonal antibody. Lane 1: ARL6IP transfected lysate(22.44 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Related products: | - ARL6IP MaxPab mouse polyclonal antibody (B02) - ARL6IP1 purified MaxPab mouse polyclonal antibody (B02P) - ACSBG1 MaxPab mouse polyclonal antibody (B01) - ACSBG1 purified MaxPab mouse polyclonal antibody (B01P) - SYT11 polyclonal antibody (A01) |
Shipping condition: | Dry Ice |