Login to display prices
Login to display prices
FBXL7 monoclonal antibody (M01), clone 2G10 View larger

FBXL7 monoclonal antibody (M01), clone 2G10

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL7 monoclonal antibody (M01), clone 2G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about FBXL7 monoclonal antibody (M01), clone 2G10

Reference: H00023194-M01
Product name: FBXL7 monoclonal antibody (M01), clone 2G10
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXL7.
Clone: 2G10
Isotype: IgG2b Kappa
Gene id: 23194
Gene name: FBXL7
Gene alias: FBL6|FBL7
Gene description: F-box and leucine-rich repeat protein 7
Genbank accession: NM_012304
Immunogen: FBXL7 (NP_036436, 392 a.a. ~ 489 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPA
Protein accession: NP_036436
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: