FBXL7 monoclonal antibody (M01), clone 2G10 View larger

FBXL7 monoclonal antibody (M01), clone 2G10

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL7 monoclonal antibody (M01), clone 2G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about FBXL7 monoclonal antibody (M01), clone 2G10

Brand: Abnova
Reference: H00023194-M01
Product name: FBXL7 monoclonal antibody (M01), clone 2G10
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXL7.
Clone: 2G10
Isotype: IgG2b Kappa
Gene id: 23194
Gene name: FBXL7
Gene alias: FBL6|FBL7
Gene description: F-box and leucine-rich repeat protein 7
Genbank accession: NM_012304
Immunogen: FBXL7 (NP_036436, 392 a.a. ~ 489 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPA
Protein accession: NP_036436
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023194-M01-1-7-1.jpg
Application image note: FBXL7 monoclonal antibody (M01), clone 2G10. Western Blot analysis of FBXL7 expression in MCF-7.
Applications: WB-Ce,S-ELISA,ELISA
Related products: - ATP11B monoclonal antibody (M01), clone 4H8
- ARL6IP monoclonal antibody (M09), clone 4F9
- SYT11 monoclonal antibody (M03), clone 4E1
- SULF1 monoclonal antibody (M01A), clone 1A4
- FBXO28 monoclonal antibody (M01), clone 3E5
Shipping condition: Dry Ice

Buy FBXL7 monoclonal antibody (M01), clone 2G10 now

Add to cart