FBXL7 polyclonal antibody (A01) View larger

FBXL7 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL7 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FBXL7 polyclonal antibody (A01)

Brand: Abnova
Reference: H00023194-A01
Product name: FBXL7 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FBXL7.
Gene id: 23194
Gene name: FBXL7
Gene alias: FBL6|FBL7
Gene description: F-box and leucine-rich repeat protein 7
Genbank accession: NM_012304
Immunogen: FBXL7 (NP_036436, 392 a.a. ~ 489 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPA
Protein accession: NP_036436
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023194-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - UBXD8 MaxPab mouse polyclonal antibody (B01)
- UBXD8 purified MaxPab mouse polyclonal antibody (B01P)
- ATP11B polyclonal antibody (A01)
- ARL6IP MaxPab mouse polyclonal antibody (B01)
- ARL6IP MaxPab mouse polyclonal antibody (B02)
Shipping condition: Dry Ice

Buy FBXL7 polyclonal antibody (A01) now

Add to cart