Login to display prices
Login to display prices
GANAB (Human) Recombinant Protein (Q01) View larger

GANAB (Human) Recombinant Protein (Q01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GANAB (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about GANAB (Human) Recombinant Protein (Q01)

Reference: H00023193-Q01
Product name: GANAB (Human) Recombinant Protein (Q01)
Product description: Human GANAB partial ORF ( NP_938149, 865 a.a. - 957 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 23193
Gene name: GANAB
Gene alias: G2AN|GluII|KIAA0088
Gene description: glucosidase, alpha; neutral AB
Genbank accession: NM_198335
Immunogen sequence/protein sequence: LDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASD
Protein accession: NP_938149
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: