No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023189-M01 |
Product name: | ANKRD15 monoclonal antibody (M01), clone 2B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ANKRD15. |
Clone: | 2B8 |
Isotype: | IgG2a Kappa |
Gene id: | 23189 |
Gene name: | KANK1 |
Gene alias: | ANKRD15|DKFZp451G231|KANK|KIAA0172|MGC43128 |
Gene description: | KN motif and ankyrin repeat domains 1 |
Genbank accession: | BC038116 |
Immunogen: | ANKRD15 (AAH38116, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDD |
Protein accession: | AAH38116 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged ANKRD15 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |