No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00023176-M08 |
| Product name: | SEPT8 monoclonal antibody (M08), clone 3G1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SEPT8. |
| Clone: | 3G1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23176 |
| Gene name: | SEPT8 |
| Gene alias: | KIAA0202|SEP2 |
| Gene description: | septin 8 |
| Genbank accession: | BC001329 |
| Immunogen: | SEPT8 (AAH01329, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKN |
| Protein accession: | AAH01329 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to SEPT8 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |