No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00023175-M03 |
Product name: | LPIN1 monoclonal antibody (M03), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LPIN1. |
Clone: | 3D9 |
Isotype: | IgG2a Kappa |
Gene id: | 23175 |
Gene name: | LPIN1 |
Gene alias: | DKFZp781P1796|KIAA0188|PAP1 |
Gene description: | lipin 1 |
Genbank accession: | NM_145693 |
Immunogen: | LPIN1 (NP_663731.1, 792 a.a. ~ 890 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA |
Protein accession: | NP_663731.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LPIN1 expression in transfected 293T cell line by LPIN1 monoclonal antibody (M03), clone 3D9. Lane 1: LPIN1 transfected lysate (Predicted MW: 98.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |