No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023166-M05 |
Product name: | STAB1 monoclonal antibody (M05), clone 4G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STAB1. |
Clone: | 4G9 |
Isotype: | IgG2a Kappa |
Gene id: | 23166 |
Gene name: | STAB1 |
Gene alias: | CLEVER-1|FEEL-1|FELE-1|FEX1|KIAA0246|STAB-1 |
Gene description: | stabilin 1 |
Genbank accession: | NM_015136 |
Immunogen: | STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ |
Protein accession: | NP_055951 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged STAB1 is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Alteration of pancreatic carcinoma and promyeloblastic cell adhesion in liver microvasculature by co-culture of hepatocytes, hepatic stellate cells and endothelial cells in a physiologically-relevant model.Danoy M, Shinohara M, Rizki-Safitri A, Collard D, Senez V, Sakai Y. Integr Biol (Camb). 2017 Apr 18;9(4):350-361. Epub 2017 Mar 21. |