Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STAB1 monoclonal antibody (M05), clone 4G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about STAB1 monoclonal antibody (M05), clone 4G9
| Brand: | Abnova |
| Reference: | H00023166-M05 |
| Product name: | STAB1 monoclonal antibody (M05), clone 4G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STAB1. |
| Clone: | 4G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23166 |
| Gene name: | STAB1 |
| Gene alias: | CLEVER-1|FEEL-1|FELE-1|FEX1|KIAA0246|STAB-1 |
| Gene description: | stabilin 1 |
| Genbank accession: | NM_015136 |
| Immunogen: | STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ |
| Protein accession: | NP_055951 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged STAB1 is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Alteration of pancreatic carcinoma and promyeloblastic cell adhesion in liver microvasculature by co-culture of hepatocytes, hepatic stellate cells and endothelial cells in a physiologically-relevant model.Danoy M, Shinohara M, Rizki-Safitri A, Collard D, Senez V, Sakai Y. Integr Biol (Camb). 2017 Apr 18;9(4):350-361. Epub 2017 Mar 21. |