STAB1 polyclonal antibody (A01) View larger

STAB1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STAB1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about STAB1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00023166-A01
Product name: STAB1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant STAB1.
Gene id: 23166
Gene name: STAB1
Gene alias: CLEVER-1|FEEL-1|FELE-1|FEX1|KIAA0246|STAB-1
Gene description: stabilin 1
Genbank accession: NM_015136
Immunogen: STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ
Protein accession: NP_055951
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023166-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023166-A01-1-34-1.jpg
Application image note: STAB1 polyclonal antibody (A01), Lot # 060707JCS1 Western Blot analysis of STAB1 expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STAB1 polyclonal antibody (A01) now

Add to cart