Brand: | Abnova |
Reference: | H00023113-M01 |
Product name: | PARC monoclonal antibody (M01), clone 3F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PARC. |
Clone: | 3F7 |
Isotype: | IgG2a Kappa |
Gene id: | 23113 |
Gene name: | CUL9 |
Gene alias: | DKFZp686G1042|DKFZp686P2024|H7AP1|PARC|RP3-330M21.2 |
Gene description: | cullin 9 |
Genbank accession: | NM_015089 |
Immunogen: | PARC (NP_055904, 918 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF |
Protein accession: | NP_055904 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |