PARC polyclonal antibody (A01) View larger

PARC polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PARC polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PARC polyclonal antibody (A01)

Brand: Abnova
Reference: H00023113-A01
Product name: PARC polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PARC.
Gene id: 23113
Gene name: CUL9
Gene alias: DKFZp686G1042|DKFZp686P2024|H7AP1|PARC|RP3-330M21.2
Gene description: cullin 9
Genbank accession: NM_015089
Immunogen: PARC (NP_055904, 918 a.a. ~ 1025 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF
Protein accession: NP_055904
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023113-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PARC polyclonal antibody (A01) now

Add to cart