| Brand: | Abnova |
| Reference: | H00023107-D01P |
| Product name: | MRPS27 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human MRPS27 protein. |
| Gene id: | 23107 |
| Gene name: | MRPS27 |
| Gene alias: | FLJ21764|FLJ23348|KIAA0264|MRP-S27|S27mt |
| Gene description: | mitochondrial ribosomal protein S27 |
| Genbank accession: | BC030521 |
| Immunogen: | MRPS27 (AAH30521.1, 1 a.a. ~ 168 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA |
| Protein accession: | AAH30521.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MRPS27 MaxPab rabbit polyclonal antibody. Western Blot analysis of MRPS27 expression in Jurkat. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |