No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00023107-D01P |
Product name: | MRPS27 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human MRPS27 protein. |
Gene id: | 23107 |
Gene name: | MRPS27 |
Gene alias: | FLJ21764|FLJ23348|KIAA0264|MRP-S27|S27mt |
Gene description: | mitochondrial ribosomal protein S27 |
Genbank accession: | BC030521 |
Immunogen: | MRPS27 (AAH30521.1, 1 a.a. ~ 168 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA |
Protein accession: | AAH30521.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MRPS27 MaxPab rabbit polyclonal antibody. Western Blot analysis of MRPS27 expression in Jurkat. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |