| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00023107-B01 |
| Product name: | MRPS27 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MRPS27 protein. |
| Gene id: | 23107 |
| Gene name: | MRPS27 |
| Gene alias: | FLJ21764|FLJ23348|KIAA0264|MRP-S27|S27mt |
| Gene description: | mitochondrial ribosomal protein S27 |
| Genbank accession: | BC030521 |
| Immunogen: | MRPS27 (AAH30521, 1 a.a. ~ 168 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA |
| Protein accession: | AAH30521 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MRPS27 expression in transfected 293T cell line (H00023107-T01) by MRPS27 MaxPab polyclonal antibody. Lane 1: MRPS27 transfected lysate(18.48 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis.Tang T, Zheng B, Chen SH, Murphy AN, Kudlicka K, Zhou H, Farquhar MG. J Biol Chem. 2009 Feb 20;284(8):5414-24. Epub 2008 Dec 22. |