| Brand: | Abnova |
| Reference: | H00023097-M03 |
| Product name: | CDC2L6 monoclonal antibody (M03), clone 2C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC2L6. |
| Clone: | 2C6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23097 |
| Gene name: | CDC2L6 |
| Gene alias: | CDK11|KIAA1028|bA346C16.3 |
| Gene description: | cell division cycle 2-like 6 (CDK8-like) |
| Genbank accession: | NM_015076 |
| Immunogen: | CDC2L6 (NP_055891.1, 1 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS |
| Protein accession: | NP_055891.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CDC2L6 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |