ARHGAP26 polyclonal antibody (A01) View larger

ARHGAP26 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGAP26 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ARHGAP26 polyclonal antibody (A01)

Brand: Abnova
Reference: H00023092-A01
Product name: ARHGAP26 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ARHGAP26.
Gene id: 23092
Gene name: ARHGAP26
Gene alias: FLJ42530|GRAF|KIAA0621|OPHN1L|OPHN1L1
Gene description: Rho GTPase activating protein 26
Genbank accession: NM_015071
Immunogen: ARHGAP26 (NP_055886, 249 a.a. ~ 336 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCF
Protein accession: NP_055886
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023092-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.79 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARHGAP26 polyclonal antibody (A01) now

Add to cart