| Brand: | Abnova |
| Reference: | H00023071-M01A |
| Product name: | TXNDC4 monoclonal antibody (M01A), clone 3C7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TXNDC4. |
| Clone: | 3C7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 23071 |
| Gene name: | TXNDC4 |
| Gene alias: | ERP44|KIAA0573 |
| Gene description: | thioredoxin domain containing 4 (endoplasmic reticulum) |
| Genbank accession: | BC005374 |
| Immunogen: | TXNDC4 (AAH05374, 30 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL |
| Protein accession: | AAH05374 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (67.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TXNDC4 monoclonal antibody (M01A), clone 3C7. Western Blot analysis of TXNDC4 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |