| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00023043-M03 |
| Product name: | TNIK monoclonal antibody (M03), clone 3D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNIK. |
| Clone: | 3D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23043 |
| Gene name: | TNIK |
| Gene alias: | - |
| Gene description: | TRAF2 and NCK interacting kinase |
| Genbank accession: | BC055427 |
| Immunogen: | TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL |
| Protein accession: | AAH55427 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M03), clone 3D4. Lane 1: TNIK transfected lysate(60.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The kinase TNIK is an essential activator of Wnt target genes.Mahmoudi T, Li VS, Ng SS, Taouatas N, Vries RG, Mohammed S, Heck AJ, Clevers H. EMBO J. 2009 Oct 8. [Epub ahead of print] |