| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00023043-M01 |
| Product name: | TNIK monoclonal antibody (M01), clone 2D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNIK. |
| Clone: | 2D2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23043 |
| Gene name: | TNIK |
| Gene alias: | - |
| Gene description: | TRAF2 and NCK interacting kinase |
| Genbank accession: | BC055427 |
| Immunogen: | TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL |
| Protein accession: | AAH55427 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M01), clone 2D2. Lane 1: TNIK transfected lysate(60.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |