Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AOF2 monoclonal antibody (M04), clone 2E7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about AOF2 monoclonal antibody (M04), clone 2E7
| Brand: | Abnova |
| Reference: | H00023028-M04 |
| Product name: | AOF2 monoclonal antibody (M04), clone 2E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AOF2. |
| Clone: | 2E7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23028 |
| Gene name: | AOF2 |
| Gene alias: | BHC110|KDM1|KIAA0601|LSD1 |
| Gene description: | amine oxidase (flavin containing) domain 2 |
| Genbank accession: | NM_015013 |
| Immunogen: | AOF2 (NP_055828, 753 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS |
| Protein accession: | NP_055828 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to AOF2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Characterization of histone lysine-specific demethylase in relation to thyroid hormone-regulated anuran metamorphosis.Chen W, Obara M, Ishida Y, Suzuki K, Yoshizato K. Dev Growth Differ. 2007 May;49(4):325-34. |